PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN15471.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family NF-YB
Protein Properties Length: 99aa    MW: 11465.2 Da    PI: 9.0093
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN15471.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB111.84e-35189896
       NF-YB  8 lPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelege 96
                +Pi+nv++i  ++lP+nakis da +++q+ ++++i fvt +a ++cq e rk +n++dllwa+ +lGf+dyvepl++++++yr++eg 
  KHN15471.1  1 MPITNVTKITGQILPNNAKISYDAMDMIQQGATKYINFVTRKAKEQCQSEYRKIMNAEDLLWAMKKLGFNDYVEPLTAFVQRYRNIEGS 89
                8*************************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF471131.3E-23190IPR009072Histone-fold
Gene3DG3DSA:1.10.20.102.0E-31189IPR009072Histone-fold
PfamPF008084.3E-15164IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.1E-112846No hitNo description
PRINTSPR006151.1E-114765No hitNo description
PRINTSPR006151.1E-116684No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 99 aa     Download sequence    Send to blast
MPITNVTKIT GQILPNNAKI SYDAMDMIQQ GATKYINFVT RKAKEQCQSE YRKIMNAEDL  60
LWAMKKLGFN DYVEPLTAFV QRYRNIEGSD LFTSHKEPI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A3e-24184992NF-YB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014628426.12e-69PREDICTED: nuclear transcription factor Y subunit beta-like
SwissprotQ84W663e-32NFYB6_ARATH; Nuclear transcription factor Y subunit B-6
TrEMBLA0A0B2Q1K01e-70A0A0B2Q1K0_GLYSO; Nuclear transcription factor Y subunit B-6 (Fragment)
TrEMBLA0A0R0KTG72e-69A0A0R0KTG7_SOYBN; Uncharacterized protein
STRINGGLYMA07G29695.19e-55(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59134150
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47670.28e-34nuclear factor Y, subunit B6
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]